TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q8VRL8|Q8VRL8_THETH Competence protein PilM OS=Thermus thermophilus GN=pilM PE=4 SV=1
MFKSLSQLFRPRVEALGLEIGASALKLVEVSGNPPALKALASRPTPPGLLMEGMVAEPAALAQEIKELLLEARTRKRYVV
TALSNLAVILRPIQVPKMPLKEMEEAVRWEAERYIPFPIDEVVLDFAPLTPLSEVQEGEQVQVMVAAARQEAVAGVLEAL
RGAGLVPVVLDVKPFAGLYPLEARLAEEPDRVFLVLDIGAESTSLVLLRGDKPLAVRVLTLSGKDFTEAIARSFNLDLLA
AEEVKRTYGMATLPTEDEELLLDFDAERERYSPGRIYDAIRPVLVELTQELRRSLEFFRIQLEEASPEMGYLLGGGSKLR
GLASLLTDTLGVNFEPVNPWEAVAVDPKRFESEQLQEIGPEFAVALGLALRGVEPLD