TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q92843|B2CL2_HUMAN Bcl-2-like protein 2 OS=Homo sapiens GN=BCL2L2 PE=1 SV=2
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK