TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q93533|Q93533_CAEEL Protein F20D1.1, confirmed by transcript evidence OS=Caenorhabditis elegans GN=F20D1.1 PE=1 SV=1
MGAAASGVSTQMQAEHDPNAAFPWWVRFLAKGVAILGGFLSLFFGVLGLITLSATCMVAILLQMTAGALVIALEAPFCCQ
FVDFIEKIARFSESRALWHKAAIYGAMGLIPIFLCIELNTILGSGTIFASGVIYGFMALGKKADRSNMMAAGDPAWSPQV
NQSNIP