TCDB is operated by the Saier Lab Bioinformatics Group
>Q94AG6|Q94AG6_ARATH Putative mitochondrial carrier protein - Arabidopsis thaliana (Mouse-ear cress).
MAPLTLSVDVKSSSATSHDVSKRVMQSSQLKINKGFFASVNTQEDKPFDFFRTLFEGFIAGGTAGVVVETALYPIDTIKT
RLQAARGGGKIVLKGLYSGLAGNIAGVLPASALFVGVYEPTKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVK
QRMQTGQFTSAPSAVRMIASKEGFRGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARRELSDPENALIGAFAGALT
GAVTTPLDVIKTRLMVQGSAKQYQGIVDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIFFGVLESTKRTLAQRRPNTVK
ETKEE