TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q96B42|TMM18_HUMAN Transmembrane protein 18 OS=Homo sapiens GN=TMEM18 PE=1 SV=2
MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLF
SKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED