TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q96HP8|T176A_HUMAN Transmembrane protein 176A OS=Homo sapiens OX=9606 GN=TMEM176A PE=2 SV=1
MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQARGSSRLLVASWVMQIVLGILSAVLGGFFYIRDY
TLLVTSGAAIWTGAVAVLAGAAAFIYEKRGGTYWALLRTLLTLAAFSTAIAALKLWNEDFRYGYSYYNSACRISSSSDWN
TPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLLLASLTPLWLYCWRMFPTKGKRDQKEMLEVSGI