TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q978Q1|Q978Q1_THEVO Uncharacterized protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1364 PE=4 SV=1
MNGFIPIIASIAISLPLLIFGSHSDVKKRSINSFTFLPIFILALAFYILDKDVVMSIVTILSTVAVFIKPNIYVYIVLPL
IIIGIGFFDTINLLTILIVGMFLLTGFGELLFGIGDIKGIVSVVLLFSSIPRFNNYIPFSIVFVFFIAVASGGALLYFVV
YARLNGLKLRGLNVLYDEHEYLRNTIKYQLKDTNSGKVMIYRVPFLVPILVSTVLSLIAQLIIYASIHT