TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9BMK9|CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans GN=clh-3 PE=1 SV=1
MGIGTKILSKIEKNKTSDGLTIPLTPTTQKQSSSWCSFESIKTFFRTVIRDWIFLALLGFIMASLSFGMDYAILNLQNGQ
MRLFDLVKEYHFTLAYLVWVGYVVGLILLSAVCAHYIAPQAIGSGIPEMKTILRGVILKEYLSVRTLLSKMIGLTLSLGS
GLPMGKEGPFVHVASVVASQLTRLVHGSSGGIFENESRSGEMLAAGCAVGVACTFSAPIGGVLFSIEVTSVYFAVRNYWR
GFFAATCSATLFRILRMFSVSAAVTVEAHYQTNFPPQNVFLPQELPIFALIGLVCGLAGSIFVYLHRRTVLFLRRNWLAK
MIFQKYWLIYPIFIATFISSLSFPLGLGKFMGGEERFSHTMKEFFVDCAWTAPPNDSYACPMPTSNATSSDSFDIRHWKG
DNYDYSPFVTLSSFQVVYFFLAILASTLPVPSGIFMPVFVLGAAFGRLVGEGVFSLDPYGHISGDIQFFVRPGVYAVVGA
AAFCGAVTHTVSVAVIVFELTGQLCHLLPVMIAVLIANAVASYLQPSIYDSIIRIKNLPYLPDIPHTTSLYHQMLIEQFM
ISPLVYIAKDSTVGDIKRALETKTRIRAFPLVENMESLALVGSVSRSQLQRYVDSQIGTKARFAEATRRIKQRLEDEESE
RKRREESKSDDTEDSLETTGAGERRASRFLIVPVAKNGPQVAKNETLTGLSEENARKILTVEEKQALFDAASLATPKREM
SGKTINPVHIESHHTIGDIFRSITHLSFGRQNFPKKNNHNEFDLFGEERTEWEDMMLNQKLDLSQLDIDSTPFQLSEYTS
LFKAHSLFSLLGLNRAYVTKKGQLIGVVALKELRLAIEYLQSGKVPTPGMSIFNEPPTEQSIYEKSARLESGRATGDAQN
AAFVTDNGEDDAQNDYIQPPLEVVRRGALTPNRMSELTRLENVRTTPESPHFEVSSPSTSSSCVSIDFSPLDAANSENGS
VGGLVLNVPSLPTRARSANELTRQNTHVQINLPDDVHDEKF