TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9EYX5 Zinc transport protein (Putative Zn transport protein) - Salmonella typhimurium.
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTPLLPNNVRDALAGESSRPRVS
RMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTRQRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASE
FIEELHDKIIDLEDNLLDQQIPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE
IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWRFGFSLFCILLVVLIGGVTLW
LHRSKWL