TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9FZF1|PX11A_ARATH Peroxisomal membrane protein 11A OS=Arabidopsis thaliana GN=PEX11A PE=1 SV=1
MATKAPEKITKPKDRDFLNHLETYLSKRDGVDKLLKISRYATKIILASSLIPETRSIIPRLKSFESSVGVSRKAFRLGKF
VQDINALRSSRWDSNHELVLLIIAYGGEGLYYFVEQFIWLTKSGLIDAKHSKWLQKISAWAELVGYVGSVSIKIRDLRKL
NDEESCVASTIEISVSRGLACDGEDEKMKMIKEKKTLKVLSILQDLADGLMTIADIRDGKGVLSAPNVISSAGLFSAIVS
THKNWISC