TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9GYF0|Q9GYF0_CAEEL Protein TAG-130, isoform a OS=Caenorhabditis elegans GN=tag-130 PE=2 SV=1
MRTSQAIFILIFLDSVRNQSPQVIPAKWDVVYEKETGHNMSLTVFRFQVKEQYSVARIIMSCNESTEHNPLLAVFREKLA
ILSLQVPLIVDNYEYSQVARTLCPFTEYKEGEAFTVEVTSSRPVHYNFRAELVQNFYLYNNSQRLVTASASEPVYLRYDI
PGDVDSVAVHLDSNSTICMTVSVQKIGCPVFDLPDNVNSMGLHQTMTTSATIPVEKSRMSSFYVVFVVNTNDDLCSEILS
IKPNKPTKFPLRMKSFNVTIESSMKIFDYTIPIVFWACILLLVTIVVFVYHYFDGIWERRFVSRAYTHLEDNAQEQRIRD
FYDFQRMSEDDDLKDYDLLTDCQDMMVVRAKASLTVADLSMTPYEERELKYDVYKIALAIIGIFYNITVLQLIISKAGSL
RQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVYFGTLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGL
AVIMEGISSATYHVCPNNINYQFDTALMYVIGMLGKLKIWSLRHPDMVVSAYHAFGFLGVFLMAAIAGVYVHNMIFWALF
SIIYIASMLLVSLEFYFKGIWTLNLRELRNSIRLSWVSSRHLSCVVPAYKARFFVILLLNIANTAVVVYGLEAHPKDFLS
FLLIPFIGNLFIYIIYYILMKMIYREKIPKRAIALLFAAVISWTCAGILFNQRVSDWSKMPAISRELNKPCIFLNFYDNH
DLWHLSSAFAIFFSFTAINVIDDDLMFVMRNTIRVF