TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9HC24|LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens GN=TMBIM4 PE=1 SV=3
MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGS
LGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALL
WILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK