TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9I3N5|CCMC_PSEAE Heme exporter protein C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ccmC PE=3 SV=1
MMNWTWFHKLGSPKWFYEISGRWLPWFAVAAALLIVTGCVWGLAFAPPDYQQGNSFRIIYIHVPAAFLAQSCYVMLAVAG
AVGLIWKMKIADVAVQCAAPIGAWMTFVALLTGAVWGKPTWGAWWVWDARLTAMLILLFLYFGIIALGQAISNRDSAAKA
CAVLAIVGVVNIPIIKYSVEWWNTLHQPATFTITEKPAMPVEMWLPLLIMVLGFYCFFAAMLLVRMRLEVLKRESRTAWA
KAEVKALVEKAR