TCDB is operated by the Saier Lab Bioinformatics Group
>Q9JTL9|DSBD_NEIMA Thiol:disulfide interchange protein dsbD - Neisseria meningitidis serogroup A.
MKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPADLLGQPSFSKGE
EKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDEPASAKDRFLQPS
SQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKARAFVLSVVYVQG
LSLTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSGGKIVSVFIMGIL
SALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPRAGDWMNAVKYAFGFILLAVAVYL
ATPHLPYYLVVALYTLLMLVPACMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHHFLTLNPPAEAGK
SSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADWCISCKEMAAYTLNQPEVHQAVDMERFFQIDVTANTPEHQALL
KEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR