TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9K1X6|Q9K1X6_CHLPN Putative uncharacterized protein OS=Chlamydia pneumoniae GN=CP_0823 PE=4 SV=1
MRQSFDELSQNAFKNIFNKQRFCFIFCSLCCFGFVFALFLKLCSRLAPEISLSTLGLGAFFCAFSVICASAIIVQFLLHK
ESQGETSKLCCAIKNTWSSLWLSLLVSMPFFIAMVAVVTVAMLSSFLGSLPWVGKLFHTVLIFIPYLSATALILLFLGSF
SCLFFCIPVLHNQESIDYRKLLECFRGNILRQFIGVVIALVPLALCSWLALDSFYLMTHLVEIADIHTWSFLAQMFVLIV
PIALILTPAVSFFFNFSFSFYLAKQEEEKALVK