TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9KN46|Q9KN46_VIBCH Hypothetical protein VCA0119 - Vibrio cholerae.
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKLLGEQSKDIKLLVYLLQCLHN
QVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKFFSQMAQRFTTVIEKFDFHHLDEADRQALQAAVEEWQQAVE
KQGLSSELVESVVVRITAEIKRAEQRQQVTAQSSAERETPSAATPSPAASMVVDHSSDKAAKQTLLKVADFLAEQEFGIA
LSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQDQLRHPDLALWRKVEQSLTMAPYWFEGQWMSYTIAQQLGK
SDWCQAIAEETQQFLRRLPSLLELKFKGGEPFVSDSVKEWLASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALS
MLNDGLVSAVEPRDKFYWRLLSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE