TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9L651 Hypothetical lactococcin 972 immunity protein (Lactis plasmid pBL1 DNA for lactococcin 972 operon) - Lactococcus lactis (subsp. lactis) (Streptococcus lactis).
MYKKLERVLITLSIVLVSAFSMIIVINKHKQMFAGTNGGVLVLKAKSNIKESIAEIAKKNNVLIAKQIMVPSTDGKTDNQ
PTFQKFGNGTLPKDFPEQKNKEFIEDSNDSVYYFIFGKTLSSIDLSKYLNEKGNTSMVSDNDWRFQGITALLDTRMIVGL
LLFLISYTSILMANIIINLKKQGVQRLAGISCFRLSFLGLKKRLTYIFITTIITLLTSSLILYIINLRRIMYFYVIIFPT
IFIVLVLLLIELIVGILVYLFLQRQKINLVIKDMAPIRALMSFVFLLQLISLLCLIFSFSSISSSHKDLVLLKKATNKWK
SQDYYSPSLLNGNTEKSKENVLRFLSEANQKEEVLIIADNFNKYPLQNQYFPTSNGNENILYVTPNYLKKVGIKFNNTMK
SDITILVPETEKSRKNKLSTLWSQAFNSLNETSFSYNSSVYKSPSKDLFTFRIFGWSAVDNQAFVQEPLIVVMSPKLFNI
NNKNINSDVLFSWFSREQILFSNNKTTADLIKKYRLENVLGSFSNGNLSVKNRFVEIKSQQLFIVVTSSIALISSTFLFY
LMNKIYLYQNRKKFAVARISGESLFTTHKTYLIQLFIIIIFAIGMIFIWHLNPLTLIIPPILGGLQLILLTRQIKNNKTF
NISVLKGE