TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9LPF1|WTR8_ARATH WAT1-related protein At1g44800 OS=Arabidopsis thaliana OX=3702 GN=At1g44800 PE=1 SV=1
MKGGSMEKIKPILAIISLQFGYAGMYIITMVSFKHGMDHWVLATYRHVVATVVMAPFALMFERKIRPKMTLAIFWRLLAL
GILEPLMDQNLYYIGLKNTSASYTSAFTNALPAVTFILALIFRLETVNFRKVHSVAKVVGTVITVGGAMIMTLYKGPAIE
IVKAAHNSFHGGSSSTPTGQHWVLGTIAIMGSISTWAAFFILQSYTLKVYPAELSLVTLICGIGTILNAIASLIMVRDPS
AWKIGMDSGTLAAVYSGVVCSGIAYYIQSIVIKQRGPVFTTSFSPMCMIITAFLGALVLAEKIHLGSIIGAVFIVLGLYS
VVWGKSKDEVNPLDEKIVAKSQELPITNVVKQTNGHDVSGAPTNGVVTST