TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9LVA7 Genomic DNA, chromosome 5, P1 clone:MMI9 (Hypothetical protein) - Arabidopsis thaliana (Mouse-ear cress).
MVAGLRDFTLRTEDGSGKPVLDESNGEELMHVQTSVAVALGNRPIESPGTLYITSRKLIWLSDVDMAKGYAVDFLSISLH
AVSRDPEAYSSPCIYTQIEVEEDEDDESDSESTEVLDLSKIREMRLVPSDSTQLETLFDVFCECAELNPEPVQEEEEESG
HNWVFSADQMDVRGGDDDAEWQISQSPTSVIGHSNGDEGLNQPMLELQINDQRFEDAEEMVHESETKDH