TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9NV96|CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens GN=TMEM30A PE=1 SV=1
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEI
DYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPY
RRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPV
YMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGG
KNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI