TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9RKM3|Y4104_STRCO UPF0126 membrane protein SCO4104 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO4104 PE=3 SV=1
MSTEPAPLLALDLTGTFAFGLNGALTAVRAARLDVVGVVVLGMITALGGGVIRDVLIDSLPPAAFLDWRYYTLAAAGGLL
AFAVSRHLRRLEPAITVLDAVGLSTFAVIGASKALDAGLAVVPAMLLGVITAVGGGTIRDTLVGRIPTVLRTGLYAIPAL
AGAAVTVATTETGVYGLPAALGAAAVCFLIRMLGLHFGINAPEPPETRPSGGGTRRQK