TCDB is operated by the Saier Lab Bioinformatics Group
>Q9SFT8|Q9SFT8_ARATH Putative integral membrane protein - Arabidopsis thaliana (Mouse-ear cress).
MSTKLWRWVLGLIYLFAVATIWIAASFVVQSVVEAGVSPFLITFICNSLFVVYLPLFEIGRYLEDAYGSLLFWRSKRSHL
MELVESEKAVLLGKDVSGVKSDATESSGLVVREQEISEGGNGIESGLENIELEIDASVNVSDGASGVSNKGLDEKGRWTR
MRVAKVSLVICPFWFLAQLTFNVSLKYTTVTSNTILSSASSLFTFLVSLIFLGEKFTWLKLFSVLLCMSGTIIVSMGDSE
SKSNAVAKNPLLGDILSLVSAALYAVYITLIRKKLPDDDERNGRVSMAQFLGFLGLFNFFIFLPPALILNFTKRERFNAL
TLKQFGLVVGKGLLDNVLSDYLWAKAVLLTTTTVATAGLTIQVPLAAIVDSLSGNKPSFTDYIGAAAVMVGFAGINIPSE
MFCKSKETAIELEPGTSFTDPPPIVPDSIRVDSSLTVV