TCDB is operated by the Saier Lab Bioinformatics Group
>Q9SJY5|Q9SJY5_ARATH Putative mitochondrial dicarboxylate carrier protein - Arabidopsis thaliana (Mouse-ear cress).
MGLKGFAEGGIASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGVGSRLIREEGMRAL
FSGVSATVLRQTLYSTTRMGLYDIIKGEWTDPETKTMPLMKKIGAGAIAGAIGAAVGNPADVAMVRMQADGRLPLTDRRN
YKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASYDSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPV
DVIKTRVMNMKVVAGVAPPYKGAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKKLFKDYDF