TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9T1W5|PORTL_BPMU Portal protein OS=Escherichia phage Mu OX=10677 GN=H PE=1 SV=1
MGRILDISGQPFDFDDEMQSRSDELAMVMKRTQEHPSSGVTPNRAAQMLRDAERGDLTAQADLAFDMEEKDTHLFSELSK
RRLAIQALEWRIAPARDASAQEKKDADMLNEYLHDAAWFEDALFDAGDAILKGYSMQEIEWGWLGKMRVPVALHHRDPAL
FCANPDNLNELRLRDASYHGLELQPFGWFMHRAKSRTGYVGTNGLVRTLIWPFIFKNYSVRDFAEFLEIYGLPMRVGKYP
TGSTNREKATLMQAVMDIGRRAGGIIPMGMTLDFQSAADGQSDPFMAMIGWAEKAISKAILGGTLTTEAGDKGARSLGEV
HDEVRREIRNADVGQLARSINRDLIYPLLALNSDSTIDINRLPGIVFDTSEAGDITALSDAIPKLAAGMRIPVSWIQEKL
HIPQPVGDEAVFTIQPVVPDNGSQKEAALSAEDIPQEDDIDRMGVSPEDWQRSVDPLLKPVIFSVLKDGPEAAMNKAASL
YPQMDDAELIDMLTRAIFVADIWGRLDAAADH