TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9UM00|TMCO1_HUMAN Transmembrane and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=TMCO1 PE=1 SV=1
MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIERQEEKLKNNN
RDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQK
ILGLAPSRAATKQAGGFLGPPPPSGKFS