TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9UYQ7|Q9UYQ7_PYRAB Membrane protein, putative OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PAB2381 PE=4 SV=1
MDETRKAELILILISAIWGSTFPVMKLGIEDYPPITFVAFRFLIASLLMLIFLRKDIKTSQALPGLLVGLSLFLGFSFQV
VGLKYTTSSNSAFITSLYMVFTPFVAILLLKTRVKLIDWVALGLALLGTYLISNVGNFNYGDMLTVLAALSFAFQIVLVE
YFGNLGIGLAFWQVFWNSMFSLAYAAIFEGLPMPREGSTLFAIIYTAIMATAIAFAVQVKYQPKIDSHRAAIIYSAEPVF
GHFFSFLILGEVLSWKGYIGALLILIAVWLEISRENLISD