TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9V4K2|GR43A_DROME Putative gustatory receptor 43a OS=Drosophila melanogaster GN=Gr43a PE=2 SV=3
MEISQPSIGIFYISKVLALAPYATVRNSKGRVEIGRSWLFTVYSATLTVVMVFLTYRGLLFDANSEIPVRMKSATSKVVT
ALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLNAYNNFRRDRWRALGMAAVSLLAISILVGLDVGTWMRIAQD
MNIAQSDTELNVHWYIPFYSLYFILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRP
AMPSALHASLTKLNGETLPSEAAAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELLS
KRDNGYLWVQMLWICFHFLRLLMVVEPCHLAARESRKTIQIVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRV
NRTILTSFASAIATYLVILIQFQRTNG