TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9VPT1|GR21A_DROME Gustatory and odorant receptor 21a OS=Drosophila melanogaster GN=Gr21a PE=2 SV=3
MTFLDRTMSFWAVSRGLTPPSKVVPMLNPNQRQFLEDEVRYREKLKLMARGDAMEEVYVRKQETVDDPLELDKHDSFYQT
TKSLLVLFQIMGVMPIHRNPPEKNLPRTGYSWGSKQVMWAIFIYSCQTTIVVLVLRERVKKFVTSPDKRFDEAIYNVIFI
SLLFTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVFPNLYPLTWSLCVFSWLLSIAINLSQYFLQPDFRLWY
TFAYYPIIAMLNCFCSLWYINCNAFGTASRALSDALQTTIRGEKPAQKLTEYRHLWVDLSHMMQQLGRAYSNMYGMYCLV
IFFTTIIATYGSISEIIDHGATYKEVGLFVIVFYCMGLLYIICNEAHYASRKVGLDFQTKLLNINLTAVDAATQKEVEML
LVAINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKITEQRRIGQQQA