TCDB is operated by the Saier Lab Bioinformatics Group
>Q9VVT2|INDY1_DROME Protein I'm not dead yet - Drosophila melanogaster (Fruit fly).
MATETTKMIYTPPPLDIKMEIEIGEQPQPPVKCSNFFANHWKGLVVFLVPLLCLPVMLLNEGAEFRCMYLLLVMAIFWVT
EALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSPRRLHFGLIMV
TMFLSMWISNAACTAMMCPIIQAVLEELQAQGVCKINHEPQYQIVGGNKKNNEDEPPYPTKITLCYYLGIAYASSLGGCG
TIIGTATNLTFKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRPKSKEAQEVQRGREGADVAKK
VIDQRYKDLGPMSIHEIQVMILFIFMVVMYFTRKPGIFLGWADLLNSKDIRNSMPTIFVVVMCFMLPANYAFLRYCTRRG
GPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGNALIGLKVLPNSVLLLVVILVAVFLTAFSSN
VAIANIIIPVLAEMSLAIEIHPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTIITIITLFVFCQ
TWGLVVYPNLNSFPEWAQIYAAAALGNKTH