TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9X807|QCRA_STRCO Cytochrome bc1 complex Rieske iron-sulfur subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=qcrA PE=3 SV=1
MSSQDIPEENLPAEQDRPHGAAARPADETNPFADPGLPPHEPRVQDVDERAAKRSERTVALLFTLSMLATIAFIAAFVAI
DVDKSVYIFPLGHISALNFALGMTLGVALFAIGAGAVHWARTLMSDEEVADERHPIEASPEVRAKVHADFKQGAKESVIG
RRKLIRNTMLGALTLVPLSGVVLLRDLGPLPGTKLRHTLWSKGKLLVNMNTNEPLRPSDVAVGSLTFAMPEGLEEHDEDF
QNEIAKAALMIIRLEPDSIKDKRELEWSHEGIVAYSKICTHVGCPISLYEQQTHHALCPCHQSTFDLADGARVIFGPAGH
ALPQLRIGVNDEGYLEALGDFEEPVGPAYWERG