TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q9XF71 CLC-NT2 PROTEIN - Nicotiana tabacum (Common tobacco).
MEEPTRLVEEATINNMDGQQNEEERDPESNSLHQPLLKRNRTLSSSPFALVGAKVSHIESLDYEINENDLFKHDWRRRSR
VQVLQYVFLKWTLAFLVGLLTGVTATLINLAIENMAGYKLRAVVNYIEDRRYLMGFAYFAGANFVLTLIAALLCVCFAPT
AAGPGIPEIKAYLNGVDTPNMYGATTLFVKIIGSIAAVSASLDLGKEGPLVHIGACFASLLGQGGPDNYRLRWRWLRYFN
NDRDRRDLITCGSSSGVCAAFRSPVGGVLFALEEVATWWRSALLWRTFFSTAVVVVILRAFIEYCKSGNCGLFGRGGLIM
FDVSGVSVSYHVVDIIPVVVIGIIGGLLGSLYNHVLHKILRLYNLINEKGKLHKVLLALSVSLFTSICMYGLPFLAKCKP
CDPSLPGSCPGTGGTGNFKQFNCPDGYYNDLATLLLTTNDDAVRNIFSINTPGEFQVMSLISYFVLYCILGLITFGIAVP
SGLFLPIILMGSAYGRLLAIAMGSYTKIDPGLYAVLGAASLMAGSMRMTVSLCVIFLELTNNLLLLPITMLVLLIAKSVG
DCFNLSIYEIILELKGLPFLDANPEPWMRNITAGELADVKPPVVTLCGVEKVGRIVEALKNTTYNGFPVVDEGVVPPVGL
PVGATELHGLVLRTHLLLVLKKKWFLHERRRTEEWEVREKFTWIDLAERGGKIEDVLVTKDEMEMYVDLHPLTNTTPYTV
VESLSVAKAMVLFRQVGLRHMLIVPKYQAAGVSPVVGILTRQDLRAHNILSVFPHLEKSKSGKKGN