TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q9Y284|ASTER_HUMAN Protein Asterix OS=Homo sapiens OX=9606 GN=WDR83OS PE=1 SV=1
MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSEDTKQM
MSSFMLSISAVVMSYLQNPQPMTPPW