TCDB is operated by the Saier Lab Bioinformatics Group
>Q9ZNY4|Q9ZNY4_SOLTU Mitochondrial energy transfer protein - Solanum tuberosum (Potato).
MGVCLFLIWGSNGVSKIQTFVLVDLFASVGQMGSMGFGVSSPNPSDSRDENGGFKLPYSDLCMKYLSFSEGFKIVGNGEE
EGVVKEKKKKGGLKIKLKVSNPSLRRLISGAIAGAISRTAVAPLGTIRTHLMVGSSGHSSTEVFNSIMKTEGWTGLFRGN
FVNVIRVAPSKAVELFVYDTVNKNLSSKPGEQSKIPIPASLVAGACAGVSSTLLTYPLELVKTRLTIQRGVYNGLLDAFV
KILKEGGPAELYRGLTPSVIGVIPYAATNYFAYDSLRKAYRKIFKEEKIGNIETLLIGSAAGAISSTATFPLEVARKHMQ
VGAVSGRAVYKNVIHALVSILEQDGIHGLYKGLGPSCMKLVPAAGISFMCYEACKRILIEAENEE