TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R1C491|R1C491_EMIHU Uncharacterized protein OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_451393 PE=4 SV=1
MHAGQSAPERGDVPGSQLPSLRERRVAATREGRSLLLPSTVGAPNAPPPPADILEQRQRMVAAANPALSQPAGAVAGEES
GEDDAQSLASIPSPASSAPPSPQRSATPGRPADTPSLGDASNLSGAAGGEAAGGEAAGSPAERERSSSSLIETSAGLLDS
VSSMLAGYAPWSPGKGRRGATRASAASCSVPTSPAASASPSIVRPAGSVAAARRFATKTRQPPRDGGGSGASPQPSALDR
EFSLRRGVSPTTERLRAYSGASGAHAKARWRQYVRRKLLNSEDEAIMNAALMSDISGDVAELIQDTTPFTARRRSEGDSS
SRPASREASRRRWSEGDGRLRSPLTVEGSPEPGFAPPSYEEGAATPPGRAAAKAAPLDAEAVHVDVGPASPEPEAGGRFP
LCRRWCLPRTRPSHHARREPGDIEGKLRDKEMEGSALAHTLSIGHGMHAPPSPDMKKARLYASQRLARQHEGDEAPGELY
PLYTPLETFDRFGTDVSQYMHFVLYTSRLFFCLFAFNLANLIINLEGQNLAFLELDSAAAGVNPLAVVHTLGNTESTGVL
AKGGHSYGVIEFITSGVLVVYIFWLRGKMSEIRTRIRNSTSLATLTAADFTVMVSHLPDGWGSDDVRGFFERFGQVVHVS
VSLNNRGLILEMKRTQELRDRHTEAALHLLTKMSRLAKKEEVVRARVRSVRSLERFERHRARLRLLMRGKYQHTGHAFVT
FNKASVTPELVRRLGKGGTDEHRALGAKLHVKRAPEPSDVLWENLQYSRRQQRQWQCLSTGIMCVLATVGIFTIFVSNYY
LAPGVNPNAAYPLPAGQFLAQMLGALVVNIGGHLIFFILVLFLAKLVEVQYTHREREKEMMIKMTVFQILSVVVPSFLYL
FLNTNANELAFNDSMGRFGASWYVSGGQFVIVALVGDATAINLFIDLVRPVPDLFNRYVLARRAKTQAKMDELWTIDADL
TLGFRVQLMNKIVFVGLMFAFAIPILYGLIFLFLFSAHWVDRYTLLRRLTPPPVTHDGLMEVVIRYIFPVAVLTHTVMAV
IFFNDICVGSKAADEGACERAFAAGFSFDNSTNSSDLLGGTCVPDVGTGDLNDLLDPERIAVKEEWAEHIRNNANFDLYS
GSVLSLECLVANASQSGAFCTVVSGCSLELSGAHVILICGAFIWGIGVVVYLLLHWCKRRRDAALGEKRRSALSTFSLNA
FRFIMQRDAPMYLPPLTRALLEMYGNNARLDRRLLKSYLQIANVPIQQGPGGSVEELRRSSLSSERSVLSSLAEPLREAS
GRVKGTVPSVEQVRTMRDALRQKLGEVEQQLSAIGDRETYQQSNTALRGGLQRGAQRLGSTFLRRKSDPRFSESDISEPE
LAPPFSPVAEEDPEGLAVDVPGDDPEGLAVDVPGDDPEGLAVDVPGDDPEGLAVDVGRAPTTDEKYLSSRLSNADFS