TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R1DEA5|R1DEA5_EMIHU Uncharacterized protein OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_248748 PE=4 SV=1
MEVDLRSGQRREFVAAEEIPAEGSSDQPHRQVRRRRKSGEVLMARQATVGAGLNQLDSMIGEMYDIKRATLPTTRSVGHR
SAASFLLTSALVLALSVLLPMVTHPRELLEAAGWQPSVCDDSCVHANDGACDDGGACRDGSDCGACGAREASLPVPSWAV
IVASLVSIAVLSLGVSTVGEMARSAGGSWGRVPLTDATLGTAVLNKFANSAQVREKGLKVLQYVLKAGAYSRLFSAGLTK
QLKDLSKATSTARRFFKFCRWVKHFEDRDLSEARDQSDRVMRLLLYFRVAANFGADWAEDVCSLERVGILPAGTLSVEFM
LFAEYCQLALALVEIWVTSARARREAELSLLAEEAGVAAPKLLSQQRKLALVRLELVKFVSDVGKAIFDCELYFAHEGVF
IGCALFSGILSTHKNMFKILK