TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R1DIT1|R1DIT1_EMIHU Uncharacterized protein OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_352039 PE=4 SV=1
MSFMFGVRAARLSLRCPTGPASRPSSMGHSLRCYSSRPSRFGNKKRTQVLEQEPEAARGGDWVSQSQVKEAPPTAAGAPA
TFPSYEQRQQQAGSQYESLSDGVVAHMRRVYATLATGIGISAAASVTAMATPLGLVHPLIPGLGAMVPLLGLMYTSKHTH
SQTLRAGLFAAFTGLSGWAMAPLLLVALKVSPAIVPQALAITTGLFGTMTALSLFAKPGSMLRLGVPLGAGMLMLLGCGV
AGMFVPVTSAWYPLLHSINLYGGLGIFTLYIAYDTQNMINEYEMGEDDHLKHAVDLFINFKVIFQRVLLLLMGRSDD