TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R1EPX1|R1EPX1_EMIHU Uncharacterized protein OS=Emiliania huxleyi CCMP1516 GN=EMIHUDRAFT_238079 PE=4 SV=1
MLSAASFSHATHLSRSLELREKIVKVLAYSTKLAAHLHGSSRLAAASKQLSAARKVFSLLHWVRHVDDASDALGESGSLR
ALALLELAAALVVDLLGDASTLVSLRLLPLSPRLAERLEWCAAAVDAVHALVALGAGAVRASRIERLQAAAPQTAGAGAK
AGADPKVGSTDAKLREKLQLARLAIVKYACDLLKASHAAGLRGLRGGGVPLPLALFAGLASGVISSHKVVVKLNGTRETH
GTPASSAKKKTS