TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R1FRI2|R1FRI2_EMIHU Uncharacterized protein OS=Emiliania huxleyi OX=2903 GN=EMIHUDRAFT_94977 PE=4 SV=1
MDLDDCFAYTTSVRVRVRHRILGCLFYGVSLSILVGYVGVYELYIRERWGELEALGGTLKAVVHGPSPAVRKPCMSFDRV
TTIAEATPQTLLVGTRLVSIVELRNKSCRAHTYGCERWAPHTRDDAFVPDVERHAVIVQHELADSASGREGFDTALPRSA
PLVSGDGGALRVVACTGVRDPDPACPFSGDLLHVRDLLFVTGLDLDAPLQATSSLRVRGVSLRLELVYNGSGYSYRARST
KLDANVLRVDTLNESARVISGLHGIGLSLVETGGMRRLEWRTVLLTIISGFALLSAAKTVADLFLLHFAPRRDDYRLFVE
QLTPDFGPDTEHEAQVLDRVSPAACPPRPPRAIKRIFRPVLCLDYVHASICAQIRRFAAGDSPWALQVGPSSAGPASGDG
VQLIGTCPAGSVLACYPGVTYALEDLPVMSKIVLPGNAYVVNHPPPHSRPNVLLYPFDLQRGQHEELQALLGVLPFRPPT
EGEPACRSAVLIATRQLADEAPLVRPAGEGTCAAGRLLVLPAAV