TCDB is operated by the Saier Lab Bioinformatics Group
>RGB34898.1 hypothetical protein C1646_760004 [Rhizophagus diaphanus]
MFSRNKNFLTTYNANQISEITNRPIHCFIYRLIQLCITAYIILLIVKGKLYLKTDPPIPGAVRLTLQEPNNFTKPSYCVD
SSPTTNPPSCAEDKLPCVYWGAKEIQYPIEETGVAFFTTRASIVKYPQGTCKILASTPEDACIINSRKPPGESVMNSSFI
ADIENYTVMIEHSIASIDGKILLKNRLMDGQFLSADDTTVIKSWWANSNEADGDILTMKEILDAAGADLSACSTAPGANK
DVNESNRSSGIIIVIVIHYEYYQNPRPISLFINNVYNYKYKPRIIDDAEYKIIEATSNIDDGSYIIKNRHGIRFVFHQHG
KIRSFSWTALIINITASLFSYRVISLIMDFSIRHEVDTWFKGIFRSNRNNDIENNEVNEETLPLIRYEDENENELI