TCDB is operated by the Saier Lab Bioinformatics Group
>RLD10056.1 hypothetical protein DRI56_03270 [Chloroflexi bacterium]
MPSIAKIQFVPNYVTELRQQIGYYIGYVPNVYADQVTADDFYEIVRKDVEIARCLHLLGLMASGEFTEVECENEKLKNLC
VFVLRQIRDFLHCRKSLVEKAVLFGLGIQRKYYRWVDYEGAKLYVAYRLAEVDRRRMRLERDQEDRTRIYWTMWCPKIDQ
YVILEDRSENPNAPEGLAVQDYIWYYQMQEELAPYWEGFGEVLYTLAYTKHYAIKYWADLCESWSKPFLVAQIDLMKAAV
NASLGAGFSSAQQRIDKIIETFEACRARHLAVIDSSDRVQWFEHGSTGANIIRELIEYCDKKIQLLLLGAELSTTAAGVG
SYALGAVHKAQTDTVVLYNRLRLAEVLTEDILFDFFYRNQSALAQLGIDFPRHGDVKIKIGVRQLSQTQEKGHLPMPQQP
VGSELWRV