TCDB is operated by the Saier Lab Bioinformatics Group
>RNA26637.1 acid-sensing ion channel 5 isoform X1 [Brachionus plicatilis]
MCSDKSNAFSVCWLDSVCIAFERTTIIRLVTRTKCDVKSIVLSTLALIKSAFESAWMRATVPSKMQQIKERIFILKLIVK
IFKFSMHFILKFFVTKIDLFLQNIYPFKNKWIEVKVRKLTIVSMFIAFKKFQKNLFYFRVKMHLILKRLVSSSSCSLTAA
CMQYRKKMISSTQNSNINLKNKLKNWILDSSSHGFPKIFKNEKPILKIIWTLCILLSIGFCCFFVIKSVVNYTKYEVTTL
VRRKIKLPLELPALSICHNEMFLTPQGYTFKTELIVSSIYQESSNIDYFSYFARLKSFDYNVSDETKKSFGFNLDSYMVS
CFFGIQSCETEEFIWYLEHYFGSCYLFNTGKYRNGSRKEFSKQTNVGSIYGFRMEFLSKKIDELTDLSESRGIHISLFDP
KTRVNPWRGINVASKYITNINVRKRMIKKIPHPYSDCLEDHSKFFSSEIYQATKTQAESYSQYLCFECLSLQFMEFFSNS
DVSKKCEKDCPLECERIEYDYTVSLTDYPTDLVANGLVELMKKKNSSKNYSLDYVNVFYDSLEYESIEELEKMDIVDLVS
SIGGLLGLFIGISVLSFAEIIEILILIVDEIFLSKSRRIVINVQNISGGVIFTRKNFQRGRCQAAVKHFHLINDSHIIF