TCDB is operated by the Saier Lab Bioinformatics Group
>RXG66789.1 DUF935 family protein [Candidatus Atribacteria bacterium 1244-E10-H5-B2]
MDLKDIFQNTKDTIKKLVRPEMGEISHSGTDIWGIGDLPVYNPDDLVEKKGLEIYRKMQRRDGQVKAIFMLKKHARLSTP
WNIRPEDEDDQDAIRQAEFIEHCFSDMKGNINNTLLKIWNAMRDGYSVAEINYKVLPTGEFKGMIGIDNIKVRKAVNYMF
KCDEHGNILEKGLIEGRNKQLPVNKFILFAYNPNDDDADSLYGESDFRAAYRYYFSNDIVQRFWNIFLEKFGQPTVIGRY
ESGTPKIKQDEYLEILKNIQTDTAIVMPKGLEAELMEAVRRGEAGYKDAFNINNAMIARSLLVGTLLMDTGEKGSWALSK
THFDIFIYVLDYLGAETEDTIVREQVIKRLIDFNFPQPKYPYFKFESLIKEDQEAKAKIAKMLVDAGLINAEEEWVRGFL
KIPAKEEGIVLPKPKPKGVGFKEDYQAKLKRQTNQYEKKCNFTRIVKNLDNFEVKAKEELGEILTRQKEALKKSIIKAKI
MESQNAREVEKLQLSYVGEFRDSVKNWLQELFRYGMNEVESELKIRRFVGLPPDKALQYLKNKSFWIAGIARDAILK