TCDB is operated by the Saier Lab Bioinformatics Group
>RYG51582.1 hypothetical protein EON66_10600, partial [archaeon]
VLDPCDAYSNFEAGCPSYITEGGDGKATILSLRSLLHAAGVRTLDAPAGSIPPLDSETLRYAGLVMVIEVQYTNYYTASG
NVRHGTGSFNPLHVDFMYRVRVVPEQDYKSLRVITPSSEAFDSTRNVYNQHGVRIILTQNGRIGTFDFQALLINLMVSLG
LLSVAIIITDFVAFKLCPLRDVYRQYAQRRTVDFSDLADTGHLAEVKSEFKVNAHAGEPHPPVIQHALEERKQRIEERAA
AMVISPTHPNPTLSSPMSISPMQQHVTSHPSHV