TCDB is operated by the Saier Lab Bioinformatics Group
>RYG56570.1 hypothetical protein EON66_02585 [archaeon]
MRGRKLLERLPGICASTPTLLRPHPARPRAQRPTSNTFTVVLYIARPVFRGWHSSQASSISPPPLPLLLKHACHHRVRHR
HHVLAPCSVLYIQASCCQAHKPPCCASRAMARAHAHIHALPRAQQCQRVAHREGFQAFLHVATLAHPPYQPLLSPYHALL
ASQQRDPRTATQLCAHVSPACEPNHASRDAAFTSLGSTNSKWKILLPLPAHQRLASRAARSLRAENDAVRRVCVQHADLH
TRGVPHTSPCAKPAAVRPRVASYWIACTPSAMTAHFCVTPRTRNAAELDLDDVFAYTTPRTVRVRDRYLGLTKYTVMIGV
FSYVIAYQLLAKQSYSAFGTIAGSVRLQLKEPSSIFRYPDGEAPYCLGGNASGSPLYSFPQPGMYKYNGPGGVVAPQGVC
QYLDARFAVNQPVEVGAVFIPSRISVSQQSAIPSSACATLGHSYCTWNTTVPDTLNYVADVDMFTLFVRSPRARAYPACL
HRVRVPTLTVVRSYCARALVRTMQIDHAFTASNGVARSAYEMSGELLDSNGEPMDPCIAYTLKQLPCPYYVNVGKQDAKD
IVPLRALMLAAGIDNLDTQTSNMTGLNDTRRYDGVVIIINIYYTNYYLKQAYAPGTGVRVQCLHAASFTLCAARCTCTRR
ARPRCLSMLVCRP