TCDB is operated by the Saier Lab Bioinformatics Group
>RZD32576.1 NAD-binding protein [Euryarchaeota archaeon]
MNWDEQVALVTGASSGIGFEMARQLADAGAQVFASARREQRLAQLAAEFPAGRITPLVADLAEAGAGARLVKQVLADAGR
LDLLVNNAGYGELVKADEQTTEAVARQMQVNFMAVIEATLAVIPTMKSQGGGRILNVASIVGHMGLPGIAAYVASKHALQ
GWSEASGYDLREHGIAVTCLCPGGTATEFDDHPSFDRHDGVSSFTQPAATVARAGLRGAWKRKPLVIPGLRNRFFLWAHD
RLPWLYRRVMYREARRIAPRD