TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S2KW97|S2KW97_9PSED Pyocin S2 immunity protein OS=Pseudomonas plecoglossicida NB2011 GN=L321_06099 PE=4 SV=1
MKISDYTERAFFEFVAGIYNADPRIYPNERSHTKAILEFEKMVEHPLGASLIFHPTRHGMKDDPGEIVQVVKAWRAEQGL
PGFKAE