TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S7QPC4|S7QPC4_GLOTA Uncharacterized protein OS=Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617) GN=GLOTRDRAFT_135844 PE=4 SV=1
MEARPPPPPPGTNYLQTIQAEVDNVLVAHTFTVLYVPLFIALLWFSTPRSRRQVSFVLNVISILLAFSVGVVIDIYAVTS
LTNPTKPLSASWTIAIGVLGIFQSILVDTILLARLFVVYPWRITSNPRRLLIFGLPIALKLARIANLIVYIKLLADAASR
HQSIELLITAPYLKVEWFLQLADNLFASVAFLAKLRPHIRGGSLGRKLKTLFYIAVSNFVIPVIFSLVQIIFLYRSKDYQ
ALNSIICVNTSVAVIGVVFATVWAGVERHGADTRAHDHGDLDTEADAYKQNIIKMMHMQESTVHDPSGTQTTTTTYAVMR
PGPESIGRSPIPPGREKRYQRPVTPEVPIFFITESGDKIPF