TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S7UTD5|S7UTD5_TOXGG DUF803 domain-containing protein OS=Toxoplasma gondii (strain ATCC 50853 / GT1) GN=TGGT1_312622 PE=4 SV=1
MNPPRLPPAGRAAVMPRRFSQEPPTDAASAPTVCASKLRLSPPGKSASSASDPTTKMQVRRSSSRLLQLVTAEPPVARTV
ITSRLCSRVYVHLGLSTLLSGAAACVLLGSPELTSALAPAGLADASQVRRLSSQLPHAIEEFLNVSGGMSLFIGILLTLV
GSVLMAGGSTMMKVGIHLESERAKNTSILMCEPMWLGGFGAYTLGALMHVVALAFAPASVLAPMNSIGLIANAITAATVL
KEPFGFQEFLFTGGTALGVTLCACATLLPHDEFVNMGSDAAMFSEKDVGLYSWRDPWYLAYLACCVVPGFGTLIYVNSEE
SAQLEEQERYMMASPRTNLKRIELARLSASQASSGAGGVEGNVGSLGLNNSEYSAQTAQKSKIFRNIQGGNDDSRCALLD
DEDSTQQQALGRKTVVYSRCIGLCYGFLAGLTGAQCVLELKELAACFHAGMDDPTIWHHPQPYLVVVFLVASVWTQIHFL
NLGLARGEATLVVPTYYVSWTFFGTLGGFAKFHEIQGFSVGAIILFGLGFGLTILCIAILAVQEMTVLRRYVDERVPDLP
EAELDLPTQELQEQQLAKQVTLAMGLFPFSMLGRTVGRKRFRPLYQRFRRTRSTASDTALNDSYGELTLSSAGVVAAYTL
PHNLHFNRGGSESLAGESRGSRREVPEVARAESLGSSPFSRHLSAAGRQTETHSSKFSSSALGESSDKTESDDRRVQRVG
HSDSQGQWPGASRPPFPGSGAGSSTRAPESSRAPGRIGWDAKPQPTVEFRVPPVTRVAGGVHGSLASPDASPTATRYSAL
PQHAQTSGKASHGL