TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S8F3F6|S8F3F6_TOXGO Chloride transporter, chloride channel (ClC) family protein OS=Toxoplasma gondii ME49 GN=TGME49_290330 PE=4 SV=1
MHLDALQSLCLLPNRLARRSLQTSGDAEEETRQDRRSGDVKMENRHACGLAGMASPVFNRGPSSPKTGAVSRETGLPDAR
RTPSVSPASSSRPCSALLSGASNRHPTPSSAFSVSSPSSSVSSPPVCLRSQASSASLRPSEEGEVVDAPCGRRQSALSHA
FSGKKSSQKSSGSFSQPRTLHLRLSDWSRRDRGPLRREGGDILLAESSADTLEPQPRLHLACDFPSVCSLTSPHTECRDL
HVASRPVVVGEDALRDQRSLEEERREEAGSRGDAETFGATPRNETTPAASVLSSAGAGTPCTSFVDADPRFCRRFPRAYL
RLTSETSVADGEESGGFAGVSERARTDRAGGGDPGGVRRLLKRMQRLRQRPPCRERERQRGDSRDGFKHKASASAWFSGD
AFRRELRKKCFQCSRTWRKLSRDPYSGAHARSVNIVDLYAAYDEVHEAPHNENLHSQLFSRVLSPSKRTGEKNDKASSAQ
RQKEAARDTPIFASSNSQERVSTAPPTTLRRCLYTSHGFCGRERISLWIALVLIGILTALVSYFLDWGVDFVLLPLQENA
VQRHSYTAIFAYSVACAVVATACCLLVPQSQGSGIPELRTVLSGSFLPDFCAWPTFFARCVGLLACICGGLSVGKEGPVV
HLSAILATQLCRLRPLQALTASPSKLLSILDVAVAAGVTATFGTPFGGVLFSIEVTATFFLVHALWKSYFCCIFCVLTFR
LLHERLSPIEQLYQGTQLPSFDVSWEVLSFAILGAVCGCLGGLFVWAASKVFQLSRKHVYPSAGRKILFVSAVMLALNVL
SHHSVVLKSEDRLKLGEFFDVESLDTNKWSSHVFLSLFLFVLFKFAATILSVACPVPAGIFTPIFVCGAALGRLYGKILR
HFVPTLSSPAAYALVGAASLAAGTTRTISVSVIVFELTGKLSHMIPVLLAVLIAYGVNGFFTISIYDVMLLIKDLPYVPK
LKSMHAYNLQAKDIMAATAYSRRAVGTATAEGEGRGDSRDSRDVRLCTDGLSRRRVQNEDLPLTVEIELPWLRSEQARTS
EKRYESTGKHDSSSRPSSPVPLLLKEKDAGNAVLMQSEEETTESSGDSPAGGSLSGVCRWSSSAVRTHEMGTELRGDHCG
SDSMPGRGEGESSGDEIEETRDHDVGCFDETPSPEDEEDAFIVAIDKERSTVLDLVFCRLLYAGVAIPVVSSVAHPRVEG
AVPLSALDRYLASLDIISVSPSAPTPAVFSPFSPRPLSRPPAFRDSRFPRRKRLSLQRLGGQVRRLLVRDSGRERRSYGS
GERRRLENRGGRSRDPGPTQTQGADKPGKYVLWKATEEEEEEEEEEEEEEEEEEETDAGLPGAEGRTGWRSCAETGRGSS
SEEASGARMEIQERRRTKESRRTDADRKRGSRVAAARRHQRRQCHETDESEKEGTVAGQRSETEQRERTAMRRRQFVSDE
TMAHSELTRLATEEMRAEEEETLATVTRRILARVLALYSPVELLCLDSFPIDWTRLEVDAAPLCVLPGTPVSKVHFMFTM
LFLGQVFVSDNAGLLLGVITKQSLMQADDAATSSLSPGTREGCQRQANTVKETFHLFSLLKSEIRRLCRPARLHARHKFP
VRIS