TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S9W5U0|S9W5U0_9TRYP Carrier protein OS=Strigomonas culicis GN=STCU_03538 PE=3 SV=1
MSVSPHAIDAARQDGNAGGANTKRVKSAVNRGWSDVNPVKMMAAFAATSFTYSFLGQPLFLVIARQQCWKSPISATDVFR
DVIQTHGWRGLYRGAGTAIAGTVVSELVYYLTVEYGKERIPFQEHEWRSFGAGLMADVTSTPVFNPFAVVSQVQMVAGSA
FSSDHNYMSAWRTTHTLVREQGVRCLFRGTLLTLVVSPLTGAWWFLYESLKRRAYAAAPALGQLASAVVPRPLRDRAPPY
LVSTTDNVLINSSVGGLTSIVVGIVMNPLYVIRLRLQVGKSMGKVRFPILHILREVYQHEGYRAFWKGLGVNLFMGVIGG
CAFGATYEGAKQLSDTRE